EYA2 purified MaxPab rabbit polyclonal antibody (D01P)
  • EYA2 purified MaxPab rabbit polyclonal antibody (D01P)

EYA2 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00002139-D01P
EYA2 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human EYA2 protein.
Información adicional
Size 100 ug
Gene Name EYA2
Gene Alias EAB1|MGC10614
Gene Description eyes absent homolog 2 (Drosophila)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MVELVISPSLTVNSDCLDKLKFNRADAAVWTLSDRQGITKSAPLRVSQLFSRSCPRVLPRQPSTAMAAYGQTQYSAGIQQATPYTAYPPPAQAYGIPSYSIKTEDSLNHSPGQSGFLSYGSSFSTSPTGQSPYTYQMHGTTGFYQGGNGLGNAAGFGSVHQDYPSYPGFPQSQYPQYYGSSYNPPYVPASSICPSPLSTSTYVLQEASHNVPNQSSESLAGEYNTHNGPSTPAKEGDTDRPHRASDGKLRGRSKR
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen EYA2 (NP_005235.3, 1 a.a. ~ 538 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 2139

Enviar un mensaje


EYA2 purified MaxPab rabbit polyclonal antibody (D01P)

EYA2 purified MaxPab rabbit polyclonal antibody (D01P)