EYA1 polyclonal antibody (A01)
  • EYA1 polyclonal antibody (A01)

EYA1 polyclonal antibody (A01)

Ref: AB-H00002138-A01
EYA1 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant EYA1.
Información adicional
Size 50 uL
Gene Name EYA1
Gene Alias BOP|BOR|MGC141875
Gene Description eyes absent homolog 1 (Drosophila)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq TPSSQTMAAYGQTQFTTGMQQATAYATYPQPGQPYGISSYGALWAGIKTEGGLSQSQSPGQTGFLSYGTSF
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen EYA1 (NP_000494, 100 a.a. ~ 170 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 2138

Enviar un mensaje


EYA1 polyclonal antibody (A01)

EYA1 polyclonal antibody (A01)