EXTL2 purified MaxPab rabbit polyclonal antibody (D02P)
  • EXTL2 purified MaxPab rabbit polyclonal antibody (D02P)

EXTL2 purified MaxPab rabbit polyclonal antibody (D02P)

Ref: AB-H00002135-D02P
EXTL2 purified MaxPab rabbit polyclonal antibody (D02P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human EXTL2 protein.
Información adicional
Size 100 ug
Gene Name EXTL2
Gene Alias EXTR2
Gene Description exostoses (multiple)-like 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Ce,WB-Tr
Immunogen Prot. Seq LLPSVKEDKMLMLRREIKSQGKSTMDSFTLIMQTYNRTDLLLKLLNHYQAVPNLHKVIVVWNNIGEKAPDELWNSLGPHPIPVIFKQQTANRMRNRLQVFPELETNAVLMVDDDTLISTPDLVFAFSVWQQFPDQIVGFVPRKHVSTSSGIYSYGSFEMQAPGSGNGDQYSMVLIGASFFNSKYLELFQRQPAAVHALIDDTQNCDDIAMNFIIAKHIGKTSGIFVKPVNMDNLEKETNSGYSGMWHRAEHALQR
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen EXTL2 (AAH36015.1, 39 a.a. ~ 330 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 2135

Enviar un mensaje


EXTL2 purified MaxPab rabbit polyclonal antibody (D02P)

EXTL2 purified MaxPab rabbit polyclonal antibody (D02P)