EXTL1 polyclonal antibody (A01)
  • EXTL1 polyclonal antibody (A01)

EXTL1 polyclonal antibody (A01)

Ref: AB-H00002134-A01
EXTL1 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant EXTL1.
Información adicional
Size 50 uL
Gene Name EXTL1
Gene Alias EXTL|MGC70794
Gene Description exostoses (multiple)-like 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq AQTGECSSMPLQWNRGRNHLVLRLHPAPCPRTFQLGQAMVAEASPTVDSFRPGFDVALPFLPEAHPLRGGAPGQLRQHSPQPGVALLALEEERGGWRTADT
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen EXTL1 (NP_004446, 141 a.a. ~ 241 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 2134

Enviar un mensaje


EXTL1 polyclonal antibody (A01)

EXTL1 polyclonal antibody (A01)