EXT2 purified MaxPab rabbit polyclonal antibody (D01P)
  • EXT2 purified MaxPab rabbit polyclonal antibody (D01P)

EXT2 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00002132-D01P
EXT2 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human EXT2 protein.
Información adicional
Size 100 ug
Gene Name EXT2
Gene Alias SOTV
Gene Description exostoses (multiple) 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MCASVKYNIRGPALIPRMKTKHRIYYITLFSIVLLGLIATGMFQFWPHSIESSNDWNVEKRSIRDVPVVRLPADSPIPERGDLSCRMHTCFDVYRCGFNPKNKIKVYIYALKKYVDDFGVSVSNTISREYNELLMAISDSDYYTDDINRACLFVPSIDVLNQNTLRIKETAQAMAQLSRWDRGTNHLLFNMLPGGPPDYNTALDVPRDRALLAGGGFSTWTYRQGYDVSIPVYSPLSAEVDLPEKGPGPRQYFLL
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen EXT2 (NP_000392.1, 1 a.a. ~ 718 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 2132

Enviar un mensaje


EXT2 purified MaxPab rabbit polyclonal antibody (D01P)

EXT2 purified MaxPab rabbit polyclonal antibody (D01P)