EXT1 monoclonal antibody (M01), clone 5A5
  • EXT1 monoclonal antibody (M01), clone 5A5

EXT1 monoclonal antibody (M01), clone 5A5

Ref: AB-H00002131-M01
EXT1 monoclonal antibody (M01), clone 5A5

Información del producto

Mouse monoclonal antibody raised against a partial recombinant EXT1.
Información adicional
Size 100 ug
Gene Name EXT1
Gene Alias EXT|LGCR|LGS|TRPS2|ttv
Gene Description exostosin 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq GERGFLKFNTIPPLRKYMLVFKGKRYLTGIGSDTRNALYHVHNGEDVVLLTTCKHGKDWQKHKDSRCDRDNTEYEKYDYREMLHNATFCLVPRGRRLGSF
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen EXT1 (AAH01174, 246 a.a. ~ 345 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 2131
Clone Number 5A5
Iso type IgG2a kappa

Enviar un mensaje


EXT1 monoclonal antibody (M01), clone 5A5

EXT1 monoclonal antibody (M01), clone 5A5