EWSR1 purified MaxPab mouse polyclonal antibody (B02P)
  • EWSR1 purified MaxPab mouse polyclonal antibody (B02P)

EWSR1 purified MaxPab mouse polyclonal antibody (B02P)

Ref: AB-H00002130-B02P
EWSR1 purified MaxPab mouse polyclonal antibody (B02P)

Información del producto

Mouse polyclonal antibody raised against a full-length human EWSR1 protein.
Información adicional
Size 50 ug
Gene Name EWSR1
Gene Alias EWS
Gene Description Ewing sarcoma breakpoint region 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IF
Immunogen Prot. Seq MASTDYSTYSQAAAQQGYSAYTAQPTQGYAQTTQAYGQQSYGTYGQPTDVSYTQAQTTATYGQTAYATSYGQPPTGYTTPTAPQAYSQPVQGYGTGAYDTTTATVTTTQASYAAQSAYGTQPAYPAYGQQPAATAPTRPQDGNKPTETSQPQSSTGGYNQPSLGYGQSNYSYPQVPGSYPMQPVTAPPSYPPTSYSSTQPTSYDQSSYSQQNTYGQPSSYGQQSSYGQQSSYGQQPPTSYPPQTGSYSQAPSQYS
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen EWSR1 (NP_005234.1, 1 a.a. ~ 656 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 2130

Enviar un mensaje


EWSR1 purified MaxPab mouse polyclonal antibody (B02P)

EWSR1 purified MaxPab mouse polyclonal antibody (B02P)