EWSR1 polyclonal antibody (A01)
  • EWSR1 polyclonal antibody (A01)

EWSR1 polyclonal antibody (A01)

Ref: AB-H00002130-A01
EWSR1 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant EWSR1.
Información adicional
Size 50 uL
Gene Name EWSR1
Gene Alias EWS
Gene Description Ewing sarcoma breakpoint region 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq SDNSAIYVQGLNDSVTLDDLADFFKQCGVVKMNKRTGQPMIHIYLDKETGKPKGDATVSYEDPPTAKAAVEWFDGKDFQGSKLKVSLARKKPPMNS
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen EWSR1 (NP_005234, 358 a.a. ~ 453 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 2130

Enviar un mensaje


EWSR1 polyclonal antibody (A01)

EWSR1 polyclonal antibody (A01)