EVC monoclonal antibody (M06), clone 3C4
  • EVC monoclonal antibody (M06), clone 3C4

EVC monoclonal antibody (M06), clone 3C4

Ref: AB-H00002121-M06
EVC monoclonal antibody (M06), clone 3C4

Información del producto

Mouse monoclonal antibody raised against a partial recombinant EVC.
Información adicional
Size 100 ug
Gene Name EVC
Gene Alias DWF-1|EVC1|EVCL|MGC105107
Gene Description Ellis van Creveld syndrome
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq VLERQRLMQCDLEEEENVRATEAVVALCQELYFSTVDTFQKFVDALFLQTLPGMTGLPPEECDYLRQEVQENAAWQLGKSNRFRRQQWKLFQELLEQDQQVWMEECALSS
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen EVC (NP_055371, 493 a.a. ~ 602 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 2121
Clone Number 3C4
Iso type IgG2a Kappa

Enviar un mensaje


EVC monoclonal antibody (M06), clone 3C4

EVC monoclonal antibody (M06), clone 3C4