EVC purified MaxPab mouse polyclonal antibody (B01P)
  • EVC purified MaxPab mouse polyclonal antibody (B01P)

EVC purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00002121-B01P
EVC purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human EVC protein.
Información adicional
Size 50 ug
Gene Name EVC
Gene Alias DWF-1|EVC1|EVCL|MGC105107
Gene Description Ellis van Creveld syndrome
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Tr
Immunogen Prot. Seq MARGGAACKSDARLLLGRDALRPAPALLAPAVLLGAALGLGLGLWLGCRAGRQRTRHQKDDTQNLLKNLESNAPTPSETGSPSRRRKREVQMSKDKEAVDECEPPSNSNITAFALKAKVIYPINQKFRPLADGSSNPSLHENLKQAVLPHQPVEASPSSSLGSLSQGEKDDCSSSSSVHSATSDDRFLSRTFLRVNAFPEVLACESVDVDLCIYSLHLKDLLHLDTALRQEKHMMFIQIFKMCLLDLLPKKKSDD
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen EVC (AAH85608.1, 1 a.a. ~ 535 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 2121

Enviar un mensaje


EVC purified MaxPab mouse polyclonal antibody (B01P)

EVC purified MaxPab mouse polyclonal antibody (B01P)