EVC polyclonal antibody (A01)
  • EVC polyclonal antibody (A01)

EVC polyclonal antibody (A01)

Ref: AB-H00002121-A01
EVC polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant EVC.
Información adicional
Size 50 uL
Gene Name EVC
Gene Alias DWF-1|EVC1|EVCL|MGC105107
Gene Description Ellis van Creveld syndrome
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq VLERQRLMQCDLEEEENVRATEAVVALCQELYFSTVDTFQKFVDALFLQTLPGMTGLPPEECDYLRQEVQENAAWQLGKSNRFRRQQWKLFQELLEQDQQVWMEECALSS
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen EVC (NP_055371, 493 a.a. ~ 602 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 2121

Enviar un mensaje


EVC polyclonal antibody (A01)

EVC polyclonal antibody (A01)