ETV6 polyclonal antibody (A01)
  • ETV6 polyclonal antibody (A01)

ETV6 polyclonal antibody (A01)

Ref: AB-H00002120-A01
ETV6 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a full-length recombinant ETV6.
Información adicional
Size 50 uL
Gene Name ETV6
Gene Alias TEL|TEL/ABL
Gene Description ets variant 6
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq MSETPAQCSIKQERISYTPPESPVPSYASSTPLHVPVPRALRMEEDSIRLPAHLRLQPIYWSRDDVAQWLKWAENEFSLRPIDSNTFEMNGKALLLLTKEDFRYRSPHSGDVLYELLQHILKQRKPRILFSPFFHPGNSIHTQPEVILHQNHEEDNCVQRTPRPSVDNVHHNPPTIELLHRSRSPITTNHRPSPDPEQRPLRSPLDNMIRRLSPAERAQGPRPHQENNHQESYPLSVSPMENNHCPASSESHPKP
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen ETV6 (AAH43399, 1 a.a. ~ 452 a.a) full-length recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 2120

Enviar un mensaje


ETV6 polyclonal antibody (A01)

ETV6 polyclonal antibody (A01)