ETV5 monoclonal antibody (M01), clone 3B10
  • ETV5 monoclonal antibody (M01), clone 3B10

ETV5 monoclonal antibody (M01), clone 3B10

Ref: AB-H00002119-M01
ETV5 monoclonal antibody (M01), clone 3B10

Información del producto

Mouse monoclonal antibody raised against a partial recombinant ETV5.
Información adicional
Size 100 ug
Gene Name ETV5
Gene Alias ERM
Gene Description ets variant 5
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq LPEPGPQQQTFAVPRPPHQPLQMPKMMPENQYPSEQRFQRQLSEPCHPFPPQPGVPGDNRPSYHRQMSEPIVPAAPPPPQGFKQEYHDPLYEHGVPGMPGPPAHGFQSPM
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen ETV5 (NP_004445, 181 a.a. ~ 290 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 2119
Clone Number 3B10
Iso type IgG1 Kappa

Enviar un mensaje


ETV5 monoclonal antibody (M01), clone 3B10

ETV5 monoclonal antibody (M01), clone 3B10