ETV4 monoclonal antibody (M01), clone 3G9-1B9
  • ETV4 monoclonal antibody (M01), clone 3G9-1B9

ETV4 monoclonal antibody (M01), clone 3G9-1B9

Ref: AB-H00002118-M01
ETV4 monoclonal antibody (M01), clone 3G9-1B9

Información del producto

Mouse monoclonal antibody raised against a full length recombinant ETV4.
Información adicional
Size 100 ug
Gene Name ETV4
Gene Alias E1A-F|E1AF|PEA3|PEAS3
Gene Description ets variant 4
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq MYLHTEGFSGPSPGDGAMGYGYEKPLRPFPDDVCVAPEKFEGDIKQEGVGAFREGPPYQRRGALQLWQFLVALLDDPTNAHFIAWTGRGMEFKLIEPEEVARLWGIQKNRPAMNYDKLSRSLRYYYEKGIMQKVAGERYVYKFVCEPEALFSLAFPDNQRPALKAEFDRPVSEEDTVPLSHLDESPAYLPELAGPAQPFGPKGGYSY
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen ETV4 (AAH07242, 1 a.a. ~ 207 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 2118
Clone Number 3G9-1B9
Iso type IgG2a kappa

Enviar un mensaje


ETV4 monoclonal antibody (M01), clone 3G9-1B9

ETV4 monoclonal antibody (M01), clone 3G9-1B9