ETV3 monoclonal antibody (M02), clone 1C11
  • ETV3 monoclonal antibody (M02), clone 1C11

ETV3 monoclonal antibody (M02), clone 1C11

Ref: AB-H00002117-M02
ETV3 monoclonal antibody (M02), clone 1C11

Información del producto

Mouse monoclonal antibody raised against a full-length recombinant ETV3.
Información adicional
Size 100 ug
Gene Name ETV3
Gene Alias METS|PE-1|PE1|bA110J1.4
Gene Description ets variant 3
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key S-ELISA,ELISA
Immunogen Prot. Seq MKAGCSIVEKPEGGGGYQFPDWAYKTESSPGSRQIQLWHFILELLQKEEFRHVIAWQQGEYGEFVIKDPDEVARLWGRRKCKPQMNYDKLSRALRYYYNKRILHKTKGKRFTYKFNFNKLVMPNYPFINIRSSGKIQTLLVGN
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen ETV3 (AAH22868, 1 a.a. ~ 143 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 2117
Clone Number 1C11
Iso type IgG2b Kappa

Enviar un mensaje


ETV3 monoclonal antibody (M02), clone 1C11

ETV3 monoclonal antibody (M02), clone 1C11