ETF1 monoclonal antibody (M02), clone 2H4
  • ETF1 monoclonal antibody (M02), clone 2H4

ETF1 monoclonal antibody (M02), clone 2H4

Ref: AB-H00002107-M02
ETF1 monoclonal antibody (M02), clone 2H4

Información del producto

Mouse monoclonal antibody raised against a partial recombinant ETF1.
Información adicional
Size 100 ug
Gene Name ETF1
Gene Alias D5S1995|ERF|ERF1|MGC111066|RF1|SUP45L1|TB3-1
Gene Description eukaryotic translation termination factor 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Tr,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq TEEEKILYLTPEQEKDKSHFTDKETGQEHELIESMPLLEWFANNYKKFGATLEIVTDKSQEGSQFVKGFGGIGGILRYRVDFQGMEYQGGDDEFFDLDDY
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen ETF1 (NP_004721.1, 338 a.a. ~ 437 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 2107
Clone Number 2H4
Iso type IgG2b Kappa

Enviar un mensaje


ETF1 monoclonal antibody (M02), clone 2H4

ETF1 monoclonal antibody (M02), clone 2H4