ESR1 monoclonal antibody (M01), clone 2F8
  • ESR1 monoclonal antibody (M01), clone 2F8

ESR1 monoclonal antibody (M01), clone 2F8

Ref: AB-H00002099-M01
ESR1 monoclonal antibody (M01), clone 2F8

Información del producto

Mouse monoclonal antibody raised against a full-length recombinant ESR1.
Información adicional
Size 100 ug
Gene Name ESR1
Gene Alias DKFZp686N23123|ER|ESR|ESRA|Era|NR3A1
Gene Description estrogen receptor 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA,IF
Immunogen Prot. Seq EVYLDSSKPAVYNYPEGAAYEFNAAAAANAQVYGQTGLPYGPGSEAAAFGSNGLGGFPPLNSVSPSPLMLLHPPPQLSPFLQPHGQQVPYYLENEPSGYT
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen ESR1 (NP_000116.2, 41 a.a. ~ 140 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 2099
Clone Number 2F8
Iso type IgG2a Kappa

Enviar un mensaje


ESR1 monoclonal antibody (M01), clone 2F8

ESR1 monoclonal antibody (M01), clone 2F8