ERH monoclonal antibody (M14), clone 4A10
  • ERH monoclonal antibody (M14), clone 4A10

ERH monoclonal antibody (M14), clone 4A10

Ref: AB-H00002079-M14
ERH monoclonal antibody (M14), clone 4A10

Información del producto

Mouse monoclonal antibody raised against a full length recombinant ERH.
Información adicional
Size 100 ug
Gene Name ERH
Gene Alias DROER|FLJ27340
Gene Description enhancer of rudimentary homolog (Drosophila)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,IHC-P,S-ELISA,ELISA,IF
Immunogen Prot. Seq MSHTILLVQPTKRPEGRTYADYESVNECMEGVCKMYEEHLKRMNPNSPSITYDISQLFDFIDDLADLSCLVYRADTQTYQPYNKDWIKEKIYVLLRRQAQQAGK
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen ERH (AAH14301, 1 a.a. ~ 104 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 2079
Clone Number 4A10
Iso type IgG1 Kappa

Enviar un mensaje


ERH monoclonal antibody (M14), clone 4A10

ERH monoclonal antibody (M14), clone 4A10