ERF monoclonal antibody (M01), clone 1E5
  • ERF monoclonal antibody (M01), clone 1E5

ERF monoclonal antibody (M01), clone 1E5

Ref: AB-H00002077-M01
ERF monoclonal antibody (M01), clone 1E5

Información del producto

Mouse monoclonal antibody raised against a partial recombinant ERF.
Información adicional
Size 100 ug
Gene Name ERF
Gene Alias PE-2|PE2
Gene Description Ets2 repressor factor
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq LGRGSVSDCSDGTSELEEPLGEDPRARPPGPPDLGAFRGPPLARLPHDPGVFRVYPRPRGGPEPLSPFPVSPLAGPGSLLPPQLSPALPMTPTHLAYTPSPTLSPMYPSG
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen ERF (AAH22231, 181 a.a. ~ 290 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 2077
Clone Number 1E5
Iso type IgG2a Kappa

Enviar un mensaje


ERF monoclonal antibody (M01), clone 1E5

ERF monoclonal antibody (M01), clone 1E5