EREG monoclonal antibody (M01), clone 1E6
  • EREG monoclonal antibody (M01), clone 1E6

EREG monoclonal antibody (M01), clone 1E6

Ref: AB-H00002069-M01
EREG monoclonal antibody (M01), clone 1E6

Información del producto

Mouse monoclonal antibody raised against a partial recombinant EREG.
Información adicional
Size 100 ug
Gene Name EREG
Gene Alias ER
Gene Description epiregulin
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key S-ELISA,ELISA,IF
Immunogen Prot. Seq STTVIPSCIPGESSDNCTALVQTEDNPRVAQVSITKCSSDMNGYCLHGQCIYLVDMSQNYCRCEVGYTGVRCEHFFLTVHQPLSKE
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen EREG (NP_001423, 32 a.a. ~ 117 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 2069
Clone Number 1E6
Iso type IgG1 Kappa

Enviar un mensaje


EREG monoclonal antibody (M01), clone 1E6

EREG monoclonal antibody (M01), clone 1E6