ERCC2 monoclonal antibody (M09), clone 2C9
  • ERCC2 monoclonal antibody (M09), clone 2C9

ERCC2 monoclonal antibody (M09), clone 2C9

Ref: AB-H00002068-M09
ERCC2 monoclonal antibody (M09), clone 2C9

Información del producto

Mouse monoclonal antibody raised against a partial recombinant ERCC2.
Información adicional
Size 100 ug
Gene Name ERCC2
Gene Alias COFS2|EM9|MGC102762|MGC126218|MGC126219|TTD|XPD
Gene Description excision repair cross-complementing rodent repair deficiency, complementation group 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key ELISA,IF
Immunogen Prot. Seq RILKARLEYLRDQFQIRENDFLTFDAMRHAAQCVGRAIRGKTDYGLMVFADKRFARGDKRGKLPRWIQEHLTDANLNLTVDEGVQVAKYFLRQMAQPFHR
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen ERCC2 (NP_000391, 631 a.a. ~ 730 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 2068
Clone Number 2C9
Iso type IgG2b Kappa

Enviar un mensaje


ERCC2 monoclonal antibody (M09), clone 2C9

ERCC2 monoclonal antibody (M09), clone 2C9