ERCC2 purified MaxPab mouse polyclonal antibody (B01P)
  • ERCC2 purified MaxPab mouse polyclonal antibody (B01P)

ERCC2 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00002068-B01P
ERCC2 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human ERCC2 protein.
Información adicional
Size 50 ug
Gene Name ERCC2
Gene Alias COFS2|EM9|MGC102762|MGC126218|MGC126219|TTD|XPD
Gene Description excision repair cross-complementing rodent repair deficiency, complementation group 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IF
Immunogen Prot. Seq MKLNVDGLLVYFPYDYIYPEQFSYMRELKRTLDAKGHGVLEMPSGTGKTVSLLALIMAYQRAYPLEVTKLIYCSRTVPEIEKVIEELRKLLNFYEKQEGEKLPFLGLALSSRKNLCIHPEVTPLRFGKDVDGKCHSLTASYVRAQYQHDTSLPHCRFYEEFDAHGREVPLPAGIYNLDDLKALGRRQGWCPYFLARYSILHANVVVYSYHYLLDPKIADLVSKELARKAVVVFDEAHNIDNVCIDSMSVNLTRRT
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen ERCC2 (NP_000391.1, 1 a.a. ~ 760 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 2068

Enviar un mensaje


ERCC2 purified MaxPab mouse polyclonal antibody (B01P)

ERCC2 purified MaxPab mouse polyclonal antibody (B01P)