ERCC1 purified MaxPab rabbit polyclonal antibody (D01P)
  • ERCC1 purified MaxPab rabbit polyclonal antibody (D01P)

ERCC1 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00002067-D01P
ERCC1 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human ERCC1 protein.
Información adicional
Size 100 ug
Gene Name ERCC1
Gene Alias COFS4|UV20
Gene Description excision repair cross-complementing rodent repair deficiency, complementation group 1 (includes overlapping antisense sequence)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MDPGKDKEGVPQPSGPPARKKFVIPLDEDEVPPGVAKPLFRSTQSLPTVDTSAQAAPQTYAEYAISQPLEGAGATCPTGSEPLAGETPNQALKPGAKSNSIIVSPRQRGNPVLKFVRNVPWEFGDVIPDYVLGQSTCALFLSLRYHNLHPDYIHGRLQSLGKNFALRVLLVQVDVKDPQQALKELAKMCILADCTLILAWSPEEAGRYLETYKAYEQKPADLLMEKLEQDFVSRVTECLTTVKSVNKTDSQTLLT
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen ERCC1 (NP_973730.1, 1 a.a. ~ 323 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 2067

Enviar un mensaje


ERCC1 purified MaxPab rabbit polyclonal antibody (D01P)

ERCC1 purified MaxPab rabbit polyclonal antibody (D01P)