ERBB3 purified MaxPab rabbit polyclonal antibody (D01P)
  • ERBB3 purified MaxPab rabbit polyclonal antibody (D01P)

ERBB3 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00002065-D01P
ERBB3 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human ERBB3 protein.
Información adicional
Size 100 ug
Gene Name ERBB3
Gene Alias ErbB-3|HER3|LCCS2|MDA-BF-1|MGC88033|c-erbB-3|c-erbB3|erbB3-S|p180-ErbB3|p45-sErbB3|p85-sErbB3
Gene Description v-erb-b2 erythroblastic leukemia viral oncogene homolog 3 (avian)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,PLA-Ce
Immunogen Prot. Seq MRANDALQVLGLLFSLARGSEVGNSQAVCPGTLNGLSVTGDAENQYQTLYKLYERCEVVMGNLEIVLTGHNADLSFLQWIREVTGYVLVAMNEFSTLPLPNLRVVRGTQVYDGKFAIFVMLNYNTNSSHALRQLRLTQLTEILSGGVYIEKNDKLCHMDTIDWRDIVRDRDAEIVVKDNGRSCPPCHEVCKGRCWGPGSEDCQTLTKTICAPQCNGHCFGPNPNQCCHDECAGGCSGPQDTDCFACRHFNDSGAC
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen ERBB3 (AAH02706.1, 1 a.a. ~ 331 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 2065

Enviar un mensaje


ERBB3 purified MaxPab rabbit polyclonal antibody (D01P)

ERBB3 purified MaxPab rabbit polyclonal antibody (D01P)