ERBB2 monoclonal antibody (M06), clone 4B8
  • ERBB2 monoclonal antibody (M06), clone 4B8

ERBB2 monoclonal antibody (M06), clone 4B8

Ref: AB-H00002064-M06
ERBB2 monoclonal antibody (M06), clone 4B8

Información del producto

Mouse monoclonal antibody raised against a partial recombinant ERBB2.
Información adicional
Size 100 ug
Gene Name ERBB2
Gene Alias CD340|HER-2|HER-2/neu|HER2|NEU|NGL|TKR1
Gene Description v-erb-b2 erythroblastic leukemia viral oncogene homolog 2, neuro/glioblastoma derived oncogene homolog (avian)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq STQVCTGTDMKLRLPASPETHLDMLRHLYQGCQVVQGNLELTYLPTNASLSFLQDIQEVQGYVLIAHNQVRQVPLQRLRIVRGTQLFEDNYALAVLDNGD
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen ERBB2 (NP_004439, 22 a.a. ~ 121 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 2064
Clone Number 4B8
Iso type IgG2b Kappa

Enviar un mensaje


ERBB2 monoclonal antibody (M06), clone 4B8

ERBB2 monoclonal antibody (M06), clone 4B8