NR2F6 polyclonal antibody (A01)
  • NR2F6 polyclonal antibody (A01)

NR2F6 polyclonal antibody (A01)

Ref: AB-H00002063-A01
NR2F6 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant NR2F6.
Información adicional
Size 50 uL
Gene Name NR2F6
Gene Alias EAR-2|EAR2|ERBAL2
Gene Description nuclear receptor subfamily 2, group F, member 6
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq ERAVAFMDQVRAFQEQVDKLGRLQVDSAEYGCLKAIALFTPDACGLSDPAHVESLQEKAQVALTEYVRAQYPSQPQRFG
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen NR2F6 (NP_005225, 273 a.a. ~ 351 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 2063

Enviar un mensaje


NR2F6 polyclonal antibody (A01)

NR2F6 polyclonal antibody (A01)