EPOR purified MaxPab rabbit polyclonal antibody (D01P)
  • EPOR purified MaxPab rabbit polyclonal antibody (D01P)

EPOR purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00002057-D01P
EPOR purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human EPOR protein.
Información adicional
Size 100 ug
Gene Name EPOR
Gene Alias MGC138358
Gene Description erythropoietin receptor
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr
Immunogen Prot. Seq MDHLGASLWPQVGSLCLLLAGAAWAPPPNLPDPKFESKAALLAARGPEELLCFTERLEDLVCFWEEAASAGVGPGNYSFSYQLEDEPWKLCRLHQAPTARGAVRFWCSLPTADTSSFVPLELRVTAASGAPRYHRVIHINEVVLLDAPVGLVARLADESGHVVLRWLPPPETPMTSHIRYEVDVSAGNGAGSVQRVEILEGRTECVLSNLRGRTRYTFAVRARMAEPSFGGFWSAWSEPVSLLTPSDLDPLILTL
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen EPOR (NP_000112.1, 1 a.a. ~ 508 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 2057

Enviar un mensaje


EPOR purified MaxPab rabbit polyclonal antibody (D01P)

EPOR purified MaxPab rabbit polyclonal antibody (D01P)