EPOR polyclonal antibody (A01)
  • EPOR polyclonal antibody (A01)

EPOR polyclonal antibody (A01)

Ref: AB-H00002057-A01
EPOR polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant EPOR.
Información adicional
Size 50 uL
Gene Name EPOR
Gene Alias MGC138358
Gene Description erythropoietin receptor
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq PDPKFESKAALLAARGPEELLCFTERLEDLVCFWEEAASAGVGPGNYSFSYQLEDEPWKLCRLHQAPTARGAVRFWCSLPTADTSSFVPLELRVTAASGA
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen EPOR (NP_000112, 31 a.a. ~ 130 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 2057

Enviar un mensaje


EPOR polyclonal antibody (A01)

EPOR polyclonal antibody (A01)