EPO monoclonal antibody (M02), clone 1B12
  • EPO monoclonal antibody (M02), clone 1B12

EPO monoclonal antibody (M02), clone 1B12

Ref: AB-H00002056-M02
EPO monoclonal antibody (M02), clone 1B12

Información del producto

Mouse monoclonal antibody raised against a full-length recombinant EPO.
Información adicional
Size 100 ug
Gene Name EPO
Gene Alias EP|MGC138142
Gene Description erythropoietin
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq MGVHECPAWLWLLLSLLSLPLGLPVLGAPPRLICDSRVLERYLLEAKEAENITTGCAEHCSLNENITVPDTKVNFYAWKRMEVGQQAVEVWQGLALLSEAVLRGQALLVNSSQPWEPLQLHVDKAVSGLRSLTTLLRALGAQKEAISPPDAASAAPLRTITADTFRKLFRVYSNFLRGKLKLYTGEACRTGDR
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen EPO (NP_000790.2, 1 a.a. ~ 193 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 2056
Clone Number 1B12
Iso type IgG1 Kappa

Enviar un mensaje


EPO monoclonal antibody (M02), clone 1B12

EPO monoclonal antibody (M02), clone 1B12