EPO purified MaxPab rabbit polyclonal antibody (D01P)
  • EPO purified MaxPab rabbit polyclonal antibody (D01P)

EPO purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00002056-D01P
EPO purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human EPO protein.
Información adicional
Size 100 ug
Gene Name EPO
Gene Alias EP|MGC138142
Gene Description erythropoietin
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MGVHECPAWLWLLLSLLSLPLGLPVLGAPPRLICDSRVLERYLLEAKEAENITTGCAEHCSLNENITVPDTKVNFYAWKRMEVGQQAVEVWQGLALLSEAVLRGQALLVNSSQPWEPLQLHVDKAVSGLRSLTTLLRALGAQKEAISPPDAASAAPLRTITADTFRKLFRVYSNFLRGKLKLYTGEACRTGDR
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen EPO (NP_000790.2, 1 a.a. ~ 193 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 2056

Enviar un mensaje


EPO purified MaxPab rabbit polyclonal antibody (D01P)

EPO purified MaxPab rabbit polyclonal antibody (D01P)