EPHX2 MaxPab rabbit polyclonal antibody (D01)
  • EPHX2 MaxPab rabbit polyclonal antibody (D01)

EPHX2 MaxPab rabbit polyclonal antibody (D01)

Ref: AB-H00002053-D01
EPHX2 MaxPab rabbit polyclonal antibody (D01)

Información del producto

Rabbit polyclonal antibody raised against a full-length human EPHX2 protein.
Información adicional
Size 100 uL
Gene Name EPHX2
Gene Alias CEH|SEH
Gene Description epoxide hydrolase 2, cytoplasmic
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IP
Immunogen Prot. Seq MTLRAAVFDLDGVLALPAVFGVLGRTEEALALPRGLLNDAFQKGGPEGATTRLMKGEITLSQWIPLMEENCRKCSETAKVCLPKNFSIKEIFDKAISARKINRPMLQAALMLRKKGFTTAILTNTWLDDRAERDGLAQLMCELKMHFDFLIESCQVGMVKPEPQIYKFLLDTLKASPSEVVFLDDIGANLKPARDLGMVTILVQDTDTALKELEKVTGIQLLNTPAPLPTSCNPSDMSHGYVTVKPRVRLHFVEL
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen EPHX2 (NP_001970.2, 1 a.a. ~ 555 a.a) full-length human protein.
Storage Buffer No additive
Gene ID 2053

Enviar un mensaje


EPHX2 MaxPab rabbit polyclonal antibody (D01)

EPHX2 MaxPab rabbit polyclonal antibody (D01)