EPHB6 monoclonal antibody (M03), clone 5D8
  • EPHB6 monoclonal antibody (M03), clone 5D8

EPHB6 monoclonal antibody (M03), clone 5D8

Ref: AB-H00002051-M03
EPHB6 monoclonal antibody (M03), clone 5D8

Información del producto

Mouse monoclonal antibody raised against a partial recombinant EPHB6.
Información adicional
Size 100 ug
Gene Name EPHB6
Gene Alias HEP|MGC129910|MGC129911
Gene Description EPH receptor B6
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,IHC-P,S-ELISA,ELISA
Immunogen Prot. Seq DTTGETSEIGWLTYPPGGWDEVSVLDDQRRLTRTFEACHVAGAPPGTGQDNWLQTHFVERRGAQRAHIRLHFSVRACSSLGVSGGTCRETFTLYYRQAEE
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen EPHB6 (NP_004436, 23 a.a. ~ 122 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 2051
Clone Number 5D8
Iso type IgG2a Kappa

Enviar un mensaje


EPHB6 monoclonal antibody (M03), clone 5D8

EPHB6 monoclonal antibody (M03), clone 5D8