EPHB3 monoclonal antibody (M08), clone 4E9
  • EPHB3 monoclonal antibody (M08), clone 4E9

EPHB3 monoclonal antibody (M08), clone 4E9

Ref: AB-H00002049-M08
EPHB3 monoclonal antibody (M08), clone 4E9

Información del producto

Mouse monoclonal antibody raised against a partial recombinant EPHB3.
Información adicional
Size 100 ug
Gene Name EPHB3
Gene Alias ETK2|HEK2|TYRO6
Gene Description EPH receptor B3
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,IHC-P,S-ELISA,ELISA
Immunogen Prot. Seq AASLKVIASAQSGMSQPLLDRTVPDYTTFTTVGDWLDAIKMGRYKESFVSAGFASFDLVAQMTAEDLLRIGVTLAGHQKKILSSIQDMRLQMNQTLPVQ
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen EPHB3 (NP_004434, 899 a.a. ~ 997 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 2049
Clone Number 4E9
Iso type IgG1 Kappa

Enviar un mensaje


EPHB3 monoclonal antibody (M08), clone 4E9

EPHB3 monoclonal antibody (M08), clone 4E9