EPHB2 monoclonal antibody (M02), clone 3B3
  • EPHB2 monoclonal antibody (M02), clone 3B3

EPHB2 monoclonal antibody (M02), clone 3B3

Ref: AB-H00002048-M02
EPHB2 monoclonal antibody (M02), clone 3B3

Información del producto

Mouse monoclonal antibody raised against a partial recombinant EPHB2.
Información adicional
Size 100 ug
Gene Name EPHB2
Gene Alias CAPB|DRT|EPHT3|ERK|Hek5|MGC87492|PCBC|Tyro5
Gene Description EPH receptor B2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq CIANAEEVDVPIKLYCNGDGEWLVPIGRCMCKAGFEAVENGTVCRGCPSGTFKANQGDEACTHCPINSRTTSEGATNCVCRNGYYRADLDPLDMPCTTIP
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen EPHB2 (NP_059145, 226 a.a. ~ 325 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 2048
Clone Number 3B3
Iso type IgG2a Kappa

Enviar un mensaje


EPHB2 monoclonal antibody (M02), clone 3B3

EPHB2 monoclonal antibody (M02), clone 3B3