EPHB1 monoclonal antibody (M01), clone 4G6
  • EPHB1 monoclonal antibody (M01), clone 4G6

EPHB1 monoclonal antibody (M01), clone 4G6

Ref: AB-H00002047-M01
EPHB1 monoclonal antibody (M01), clone 4G6

Información del producto

Mouse monoclonal antibody raised against a partial recombinant EPHB1.
Información adicional
Size 100 ug
Gene Name EPHB1
Gene Alias ELK|EPHT2|FLJ37986|Hek6|NET
Gene Description EPH receptor B1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq ARGTCIPNAEEVDVPIKLYCNGDGEWMVPIGRCTCKPGYEPENSVACKACPAGTFKASQEAEGCSHCPSNSRSPAEASPICTCRTGYYRADFDPPEVACT
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen EPHB1 (NP_004432.1, 221 a.a. ~ 320 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 2047
Clone Number 4G6
Iso type IgG2a Kappa

Enviar un mensaje


EPHB1 monoclonal antibody (M01), clone 4G6

EPHB1 monoclonal antibody (M01), clone 4G6