EPHA5 monoclonal antibody (M04), clone 5C8
  • EPHA5 monoclonal antibody (M04), clone 5C8

EPHA5 monoclonal antibody (M04), clone 5C8

Ref: AB-H00002044-M04
EPHA5 monoclonal antibody (M04), clone 5C8

Información del producto

Mouse monoclonal antibody raised against a partial recombinant EPHA5.
Información adicional
Size 100 ug
Gene Name EPHA5
Gene Alias CEK7|EHK1|HEK7|TYRO4
Gene Description EPH receptor A5
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq PSVVRHLAVFPDTITGADSSQLLEVSGSCVNHSVTDEPPKMHCSAEGEWLVPIGKCMCKAGYEEKNGTCQVCRPGFFKASPHIQSCGKCPPHSYTHEEAS
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen EPHA5 (NP_004430, 234 a.a. ~ 333 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 2044
Clone Number 5C8
Iso type IgG3 Kappa

Enviar un mensaje


EPHA5 monoclonal antibody (M04), clone 5C8

EPHA5 monoclonal antibody (M04), clone 5C8