EPHA1 monoclonal antibody (M14), clone 8D4
  • EPHA1 monoclonal antibody (M14), clone 8D4

EPHA1 monoclonal antibody (M14), clone 8D4

Ref: AB-H00002041-M14
EPHA1 monoclonal antibody (M14), clone 8D4

Información del producto

Mouse monoclonal antibody raised against a partial recombinant EPHA1.
Información adicional
Size 100 ug
Gene Name EPHA1
Gene Alias EPH|EPHT|EPHT1|MGC163163
Gene Description EPH receptor A1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq PGARGLTTPAVHVNGLEPYANYTFNVEAQNGVSGLGSSGHASTSVSISMGHAESLSGLSLRLVKKEPRQLELTWAGSRPRSPGANLTYELHVLNQDEERYQMVLEPR
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen EPHA1 (NP_005223, 394 a.a. ~ 500 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 2041
Clone Number 8D4
Iso type IgG2a Kappa

Enviar un mensaje


EPHA1 monoclonal antibody (M14), clone 8D4

EPHA1 monoclonal antibody (M14), clone 8D4