EPHA1 polyclonal antibody (A01)
  • EPHA1 polyclonal antibody (A01)

EPHA1 polyclonal antibody (A01)

Ref: AB-H00002041-A01
EPHA1 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant EPHA1.
Información adicional
Size 50 uL
Gene Name EPHA1
Gene Alias EPH|EPHT|EPHT1|MGC163163
Gene Description EPH receptor A1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq PGARGLTTPAVHVNGLEPYANYTFNVEAQNGVSGLGSSGHASTSVSISMGHAESLSGLSLRLVKKEPRQLELTWAGSRPRSPGANLTYELHVLNQDEERYQMVLEPR
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen EPHA1 (NP_005223, 394 a.a. ~ 500 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 2041

Enviar un mensaje


EPHA1 polyclonal antibody (A01)

EPHA1 polyclonal antibody (A01)