EPB42 MaxPab mouse polyclonal antibody (B01)
  • EPB42 MaxPab mouse polyclonal antibody (B01)

EPB42 MaxPab mouse polyclonal antibody (B01)

Ref: AB-H00002038-B01
EPB42 MaxPab mouse polyclonal antibody (B01)

Información del producto

Mouse polyclonal antibody raised against a full-length human EPB42 protein.
Información adicional
Size 50 uL
Gene Name EPB42
Gene Alias MGC116735|MGC116737|PA
Gene Description erythrocyte membrane protein band 4.2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MGQALGIKSCDFQAARNNEEHHTKALSSRRLFVRRGQPFTIILYFRAPVRAFLPALKKVALTAQTGEQPSKINRTQATFPISSLGDRKWWSAVVEERDAQSWTISVTTPADAVIGHYSLLLQVSGRKQLLLGQFTLLFNPWNREDAVFLKNEAQRMEYLLNQNGLIYLGTADCIQAESWDFGQFEGDVIDLSLRLLSKDKQVEKWSQPVHVARVLGALLHFLKEQRVLPTPQTQATQEGALLNKRRGSVPILRQW
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen EPB42 (AAH99627.1, 1 a.a. ~ 619 a.a) full-length human protein.
Storage Buffer No additive
Gene ID 2038

Enviar un mensaje


EPB42 MaxPab mouse polyclonal antibody (B01)

EPB42 MaxPab mouse polyclonal antibody (B01)