EPB41L1 polyclonal antibody (A01)
  • EPB41L1 polyclonal antibody (A01)

EPB41L1 polyclonal antibody (A01)

Ref: AB-H00002036-A01
EPB41L1 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant EPB41L1.
Información adicional
Size 50 uL
Gene Name EPB41L1
Gene Alias 4.1N|DKFZp686H17242|KIAA0338|MGC11072
Gene Description erythrocyte membrane protein band 4.1-like 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq MEEKDYSEADGLSERTTPSKAQKSPQKIAKKYKSAICRVTLLDASEYECEVEKHGRGQVLFDLVCEHLNLLEKDYFGLTFCDADSQKN
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen EPB41L1 (NP_818932, 1 a.a. ~ 88 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 2036

Enviar un mensaje


EPB41L1 polyclonal antibody (A01)

EPB41L1 polyclonal antibody (A01)