EP300 polyclonal antibody (A01)
  • EP300 polyclonal antibody (A01)

EP300 polyclonal antibody (A01)

Ref: AB-H00002033-A01
EP300 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant EP300.
Información adicional
Size 50 uL
Gene Name EP300
Gene Alias KAT3B|p300
Gene Description E1A binding protein p300
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq PPLQHHGQLAQPGALNPPMGYGPRMQQPSNQGQFLPQTQFPSQGMNVTNIPLAPSSGQAPVSQAQMSSSSCPVNSPIMPPGSQGSHIHCPQLPQPALHQN
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen EP300 (NP_001420, 731 a.a. ~ 830 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 2033

Enviar un mensaje


EP300 polyclonal antibody (A01)

EP300 polyclonal antibody (A01)