ENO3 polyclonal antibody (A01)
  • ENO3 polyclonal antibody (A01)

ENO3 polyclonal antibody (A01)

Ref: AB-H00002027-A01
ENO3 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant ENO3.
Información adicional
Size 50 uL
Gene Name ENO3
Gene Alias MSE
Gene Description enolase 3 (beta, muscle)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq KTAIQAAGYPDKVVIGMDVAASEFYRNGKYDLDFKSPDDPARHITGEKLG
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen ENO3 (NP_001967, 228 a.a. ~ 277 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 2027

Enviar un mensaje


ENO3 polyclonal antibody (A01)

ENO3 polyclonal antibody (A01)