EN1 monoclonal antibody (M04), clone 3H2
  • EN1 monoclonal antibody (M04), clone 3H2

EN1 monoclonal antibody (M04), clone 3H2

Ref: AB-H00002019-M04
EN1 monoclonal antibody (M04), clone 3H2

Información del producto

Mouse monoclonal antibody raised against a full length recombinant EN1.
Información adicional
Size 100 ug
Gene Name EN1
Gene Alias -
Gene Description engrailed homeobox 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,IHC-P,S-ELISA,ELISA
Immunogen Prot. Seq SQQPLVWPAWVYCTRYSDRPSSGPRTRKLKKKKNEKEDKRPRTAFTAEQLQRLKAEFQANRYITEQRRQTLAQELSLNESQIKIWFQNKRAKIKKATGIKNGLALHLMAQGLYNHSTTTVQDKDESE*
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen EN1 (NP_001417, 266 a.a. ~ 392 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 2019
Clone Number 3H2
Iso type IgG2a Kappa

Enviar un mensaje


EN1 monoclonal antibody (M04), clone 3H2

EN1 monoclonal antibody (M04), clone 3H2