CTTN monoclonal antibody (M01), clone 2B5
  • CTTN monoclonal antibody (M01), clone 2B5

CTTN monoclonal antibody (M01), clone 2B5

Ref: AB-H00002017-M01
CTTN monoclonal antibody (M01), clone 2B5

Información del producto

Mouse monoclonal antibody raised against a partial recombinant CTTN.
Información adicional
Size 100 ug
Gene Name CTTN
Gene Alias EMS1|FLJ34459
Gene Description cortactin
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,S-ELISA,ELISA,PLA-Ce
Immunogen Prot. Seq EAVTSKTSNIRANFENLAKEKEQEDRRKAEAERAQRMAKERQEQEEARRKLEEQARAKTQTPPVSPAPQPTEERLPSSPVYEDAASFKAELSYRGPVSGTEPEPVYSMEA
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CTTN (NP_005222.2, 341 a.a. ~ 450 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 2017
Clone Number 2B5
Iso type IgG2a Kappa

Enviar un mensaje


CTTN monoclonal antibody (M01), clone 2B5

CTTN monoclonal antibody (M01), clone 2B5