CTTN purified MaxPab rabbit polyclonal antibody (D01P)
  • CTTN purified MaxPab rabbit polyclonal antibody (D01P)

CTTN purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00002017-D01P
CTTN purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human CTTN protein.
Información adicional
Size 100 ug
Gene Name CTTN
Gene Alias EMS1|FLJ34459
Gene Description cortactin
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MWKASAGHAVSIAQDDAGADDWETDPDFVNDVSEKEQRWGAKTVQGSGHQEHINIHKLRENVFQEHQTLKEKELETGPKASHGYGGKFGVEQDRMDKSAVGHEYQSKLSKHCSQVDSVRGFGGKFGVQMDRVDQSAVGFEYQGKTEKHASQKDYSSGFGGKYGVQADRVDKSAVGFDYQGKTEKHESQRDYSKGFGGKYGIDKDKVDKSAVGFEYQGKTEKHESQKDYVKGFGGKFGVQTDRQDKCALGWDHQEK
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen CTTN (NP_612632.1, 1 a.a. ~ 513 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 2017

Enviar un mensaje


CTTN purified MaxPab rabbit polyclonal antibody (D01P)

CTTN purified MaxPab rabbit polyclonal antibody (D01P)