EMP3 monoclonal antibody (M01), clone 3D4
  • EMP3 monoclonal antibody (M01), clone 3D4

EMP3 monoclonal antibody (M01), clone 3D4

Ref: AB-H00002014-M01
EMP3 monoclonal antibody (M01), clone 3D4

Información del producto

Mouse monoclonal antibody raised against a full length recombinant EMP3.
Información adicional
Size 100 ug
Gene Name EMP3
Gene Alias YMP
Gene Description epithelial membrane protein 3
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Tr,WB-Re,IHC-P,ELISA
Immunogen Prot. Seq MSLLLLVVSALHILILILLFVATLDKSWWTLPGKESLNLWYDCTWNNDTKTWACSNVSENGWLKAVQVLMVLSLILCCLSFILFMFQLYTMRRGGLFYATGLCQLCTSVAVFTGALIYAIHAEEILEKHPRGGSFGYCFALAWVAFPLALVSGIIYIHLRKRE
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen EMP3 (AAH09718, 1 a.a. ~ 163 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 2014
Clone Number 3D4
Iso type IgG1 Kappa

Enviar un mensaje


EMP3 monoclonal antibody (M01), clone 3D4

EMP3 monoclonal antibody (M01), clone 3D4