EMP3 polyclonal antibody (A01)
  • EMP3 polyclonal antibody (A01)

EMP3 polyclonal antibody (A01)

Ref: AB-H00002014-A01
EMP3 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant EMP3.
Información adicional
Size 50 uL
Gene Name EMP3
Gene Alias YMP
Gene Description epithelial membrane protein 3
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq DKSWWTLPGKESLNLWYDCTWNNDTKTWACSNVSENGWLKAVQV
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen EMP3 (NP_001416.1, 25 a.a. ~ 68 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 2014

Enviar un mensaje


EMP3 polyclonal antibody (A01)

EMP3 polyclonal antibody (A01)