EMP1 polyclonal antibody (A01)
  • EMP1 polyclonal antibody (A01)

EMP1 polyclonal antibody (A01)

Ref: AB-H00002012-A01
EMP1 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a full-length recombinant EMP1.
Información adicional
Size 50 uL
Gene Name EMP1
Gene Alias CL-20|EMP-1|TMP
Gene Description epithelial membrane protein 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq MLVLLAGIFVVHIATVIMLFVSTIANVWLVSNTVDASVGLWKNCTNISCSDSLSYASEDALKTVQAFMILSIIFCVIALLVFVFQLFTMEKGNRFFLSGATTLVCWLCILVGVSIYTSHYANRDGTQYHHGYSYILGWICFCFSFIIGVLYLVLRKK
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen EMP1 (AAH47300, 1 a.a. ~ 157 a.a) full-length recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 2012

Enviar un mensaje


EMP1 polyclonal antibody (A01)

EMP1 polyclonal antibody (A01)