MARK2 monoclonal antibody (M02), clone 3C5
  • MARK2 monoclonal antibody (M02), clone 3C5

MARK2 monoclonal antibody (M02), clone 3C5

Ref: AB-H00002011-M02
MARK2 monoclonal antibody (M02), clone 3C5

Información del producto

Mouse monoclonal antibody raised against a partial recombinant MARK2.
Información adicional
Size 100 ug
Gene Name MARK2
Gene Alias EMK1|MGC99619|PAR-1|Par1b
Gene Description MAP/microtubule affinity-regulating kinase 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA,IF
Immunogen Prot. Seq QAAGPAIPTSNSYSKKTQSNNAENKRPEEDRESGRKASSTAKVPASPLPGLERKKTTPTPSTNSVLSTSTNRSRNSPLLERASLGQASIQNGKDSLTMPG
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen MARK2 (AAH08771, 401 a.a. ~ 500 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 2011
Clone Number 3C5
Iso type IgG2a Kappa

Enviar un mensaje


MARK2 monoclonal antibody (M02), clone 3C5

MARK2 monoclonal antibody (M02), clone 3C5