ELN purified MaxPab rabbit polyclonal antibody (D01P)
  • ELN purified MaxPab rabbit polyclonal antibody (D01P)

ELN purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00002006-D01P
ELN purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human ELN protein.
Información adicional
Size 100 ug
Gene Name ELN
Gene Alias FLJ38671|FLJ43523|SVAS|WBS|WS
Gene Description elastin
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MAGLTAAAPRPGVLLLLLSILHPSRPGGVPGAIPGGVPGGVFYPGAGLGALGGGALGPGGKPLKPVPGGLAGAGLGAGLGAFPAVTFPGALVPGGVADAAAAYKAAKAGAGLGGVPGVGGLGVSAGAVVPQPGAGVKPGKVPGVGLPGVYPGGVLPGARFPGVGVLPGVPTGAGVKPKAPGVGGAFAGIPGVGPFGGPQPGVPLGYPIKAPKLPGYGPGGVAGAAGKAGYPTGTGVGPQAAAAAAAKAAAKFGAG
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen ELN (AAH65566.1, 1 a.a. ~ 658 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 2006

Enviar un mensaje


ELN purified MaxPab rabbit polyclonal antibody (D01P)

ELN purified MaxPab rabbit polyclonal antibody (D01P)